Web Analysis for Cincinnatilawnsprinklersystem - cincinnatilawnsprinklersystem.com
1.67
Rating by CuteStat
cincinnatilawnsprinklersystem.com is 9 years 9 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, cincinnatilawnsprinklersystem.com is SAFE to browse.
PageSpeed Score
62
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | 5 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 6 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 23.229.194.8)
ACS Roofing Company | (832) 593-0027
- acsroofingcompany.com
This is valuable website which provides the information about the ACS Roofing Company.
13,213,249
$
8.95
Accent Builders DFW
- accentbuildersdfw.com
This is a valuable website which provides information about the Accent Builder DFW
Not Applicable
$
8.95
Lawn Maintenance in Cincinnati | Paramount Landscaping (513) 984-5200
- cincinnatilawnmaintenance.com
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Mon, 14 Jul 2014 00:04:52 GMT
Server: Apache mod_fcgid/2.3.10-dev
X-Powered-By: PHP/5.4.26
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://cincinnatilawnsprinklersystem.com/xmlrpc.php
Link: <http://cincinnatilawnsprinklersystem.com/>; rel=shortlink
Content-Length: 16438
Content-Type: text/html; charset=UTF-8
Date: Mon, 14 Jul 2014 00:04:52 GMT
Server: Apache mod_fcgid/2.3.10-dev
X-Powered-By: PHP/5.4.26
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://cincinnatilawnsprinklersystem.com/xmlrpc.php
Link: <http://cincinnatilawnsprinklersystem.com/>; rel=shortlink
Content-Length: 16438
Content-Type: text/html; charset=UTF-8
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
pdns05.domaincontrol.com | 97.74.110.52 | United States of America | |
pdns06.domaincontrol.com | 173.201.78.52 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
cincinnatilawnsprinklersystem.com | A | 590 |
IP: 23.229.194.8 |
cincinnatilawnsprinklersystem.com | NS | 3599 |
Target: pdns06.domaincontrol.com |
cincinnatilawnsprinklersystem.com | NS | 3599 |
Target: pdns05.domaincontrol.com |
cincinnatilawnsprinklersystem.com | SOA | 86399 |
MNAME: pdns05.domaincontrol.com RNAME: dns.jomax.net Serial: 2014070702 Refresh: 86400 Retry: 7200 Expire: 3600000 Minimum TTL: 86400 |
cincinnatilawnsprinklersystem.com | MX | 3599 |
Priority: 10 Target: mailstore1.secureserver.net |
cincinnatilawnsprinklersystem.com | MX | 3599 |
Target: smtp.secureserver.net |
Full WHOIS Lookup
Domain Name: CINCINNATILAWNSPRINKLERSYSTEM.COM
Registrar URL: http://www.godaddy.com
Registrant Name: Jim Louis
Registrant Organization:
Name Server: PDNS05.DOMAINCONTROL.COM
Name Server: PDNS06.DOMAINCONTROL.COM
DNSSEC: unsigned
For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=CINCINNATILAWNSPRINKLERSYSTEM.COM
The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.
Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.
Registrar URL: http://www.godaddy.com
Registrant Name: Jim Louis
Registrant Organization:
Name Server: PDNS05.DOMAINCONTROL.COM
Name Server: PDNS06.DOMAINCONTROL.COM
DNSSEC: unsigned
For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=CINCINNATILAWNSPRINKLERSYSTEM.COM
The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.
Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.